3.03 Rating by CuteStat

pianodomination.com is 7 years 6 days old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pianodomination.com is SAFE to browse.

PageSpeed Score
82
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.185.108.139

Hosted Country:

United States of America US

Location Latitude:

29.8284

Location Longitude:

-95.4696

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 4
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 8
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.185.108.139)

Trick Photography Ideas

- trickphotographyideas.net

how to do trick photography and special effects review

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectsreview.net

how to do trick photography and special effects

Not Applicable $ 8.95

Trick Photography

- trickphotographyspecialeffects.org

trick photography techniques how to shoot trick photos

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectspdf.net

how to do trick photography and special effects

Not Applicable $ 8.95

Fundación Instituto Hipólito Unanue

- fihu-diagnostico.org.pe
1,357,204 $ 480.00

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.12.0
Date: Mon, 12 Jun 2017 14:27:00 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Sun, 11 Jun 2017 19:45:21 GMT
Cache-Control: max-age=600
Expires: Mon, 12 Jun 2017 14:37:00 GMT
X-Endurance-Cache-Level: 2
Content-Encoding: gzip

Domain Information

Domain Registrar: Tucows Domains Inc.
Registration Date: Jun 7, 2017, 12:00 AM 7 years 6 days 18 hours ago
Last Modified: Jun 8, 2017, 12:00 AM 7 years 5 days 18 hours ago
Expiration Date: Jun 7, 2018, 12:00 AM 6 years 5 days 18 hours ago
Domain Status:
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1509.websitewelcome.com 192.185.108.133 United States of America United States of America
ns1510.websitewelcome.com 192.185.108.134 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
pianodomination.com A 14394 IP: 192.185.108.139
pianodomination.com NS 86399 Target: ns1510.websitewelcome.com
pianodomination.com NS 86399 Target: ns1509.websitewelcome.com
pianodomination.com SOA 86399 MNAME: ns1509.websitewelcome.com
RNAME: info.omnivisiondesign.com
Serial: 2017060703
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
pianodomination.com MX 14399 Target: mail.pianodomination.com
pianodomination.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: PIANODOMINATION.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1509.WEBSITEWELCOME.COM
Name Server: NS1510.WEBSITEWELCOME.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 08-jun-2017
Creation Date: 07-jun-2017
Expiration Date: 07-jun-2018

>>> Last update of whois database: Mon, 12 Jun 2017 14:26:58 GMT